ELISA Recombinant Metridium senile NADH-ubiquinone oxidoreductase chain 6(ND6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Metridium senile (Brown sea anemone) (Frilled sea anemone) Uniprot NO.:O47498 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVTMYFFTLSFGTVASGIMVISALNPVHSVFWLVVAFISSAALFILLGVDFIALMFIIIY VGAIAILFLFVIMmLNLTDFTPAFRRGGEADMTNYVPIGLAVGTLFFEAIASSWLIMGGP YVYRGLLGAWDLANPWFLKKYHNIEAIGRILYTDCYYLFILVSFILLVAmLGAIVLTQEI GTEIGPTAKKQDIFVQTSRAQV Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 6 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 6 Gene Names:Name:ND6 Expression Region:1-202 Sequence Info:fµLl length protein