Se rendre au contenu

ELISA Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B

https://infectech.genprice.com/web/image/product.template/121609/image_1920?unique=7485b17
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Others Target / Protein: Biologically active: Not Tested Expression system: E.coli Species of origin: Carpinus betµLus (European hornbeam) (Carpinus caucasica) Delivery time: 3-7 business days Uniprot ID: P38949 AA Sequence: GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN Tag info: N-terminal 6xHis-tagged Expression Region: 2-160aa Protein length: FµLl Length MW: 21.3 kDa Alternative Name(s): Relevance: Reference: PCR based cloning and sequencing of isogenes encoding the tree pollen major allergen Car b I from Carpinus betµLus, hornbeam.Nedergaard Larsen J., Stroeman P., Ipsen H.Mol. Immunol. 29:703-711(1992) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1.066,00 € 1066.0 EUR 1.066,00 €

1.066,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables