ELISA Recombinant UPF0154 protein spyM18_0409 (spyM18_0409)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus pyogenes serotype M18 Uniprot NO.:P67297 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTAIWILLLIVALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIREMMSQMGQKPSEAKIQQTYRNIIKQSKAAVSKGKK Protein Names:Recommended name: UPF0154 protein spyM18_0409 Gene Names:Ordered Locus Names:spyM18_0409 Expression Region:1-80 Sequence Info:fµLl length protein